Haptoglobin (HP) Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1571S
Artikelname: Haptoglobin (HP) Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1571S
Hersteller Artikelnummer: CNA1571S
Alternativnummer: MBL-CNA1571S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Haptoglobin (Haptoglobin (HP)) (NP_005134.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 45kDa
NCBI: 3240
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MSALGAVIALLLWGQLFAVDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNDKKQWINKAVGDKLPECEADDGCPKPPEIAH
Target-Kategorie: HP
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200