EAAT1/SLC1A3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15722T
Artikelname: EAAT1/SLC1A3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15722T
Hersteller Artikelnummer: CNA15722T
Alternativnummer: MBL-CNA15722T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 453-542 of human EAAT1/EAAT1/SLC1A3 (NP_004163.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 60kDa
NCBI: 6507
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: IVLTSVGLPTDDITLIIAVDWFLDRLRTTTNVLGDSLGAGIVEHLSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNETEKPIDSETKM
Target-Kategorie: SLC1A3
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200