SUMO3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15724T
Artikelname: SUMO3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15724T
Hersteller Artikelnummer: CNA15724T
Alternativnummer: MBL-CNA15724T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human SUMO3 (NP_008867.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 12kDa
NCBI: 6612
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG
Target-Kategorie: SUMO3
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200