SNRPN Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15726T
Artikelname: SNRPN Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15726T
Hersteller Artikelnummer: CNA15726T
Alternativnummer: MBL-CNA15726T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SNRPN (NP_003088.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 25kDa
NCBI: 6638
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNAKQPEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGA
Target-Kategorie: SNRPN
Application Verdünnung: WB: WB,1:500 - 1:2000