TAF1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15730T
Artikelname: TAF1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15730T
Hersteller Artikelnummer: CNA15730T
Alternativnummer: MBL-CNA15730T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 990-1250 of human TAF1 (NP_620278.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 213kDa
NCBI: 6872
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: GTDADLRRLSLKNAKQLLRKFGVPEEEIKKLSRWEVIDVVRTMSTEQARSGEGPMSKFARGSRFSVAEHQERYKEECQRIFDLQNKVLSSTEVLSTDTDSSSAEDSDFEEMGKNIENMLQNKKTSSQLSREREEQERKELQRMLLAAGSAASGNNHRDDDTASVTSLNSSATGRCLKIYRTFRDEEGKEYVRCETVRKPAVIDAYVRIRTTKDEEFIRKFALFDEQHREEMRKERRRIQEQLRRLKRNQEKEKL
Target-Kategorie: TAF1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200