TCHH Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15731T
Artikelname: TCHH Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15731T
Hersteller Artikelnummer: CNA15731T
Alternativnummer: MBL-CNA15731T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 100-300 of human TCHH (NP_009044.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 254kDa
NCBI: 7062
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: RARCDGKESLLQDRRQEEDQRRFEPRDRQLEEEPGQRRRQKRQEQERELAEGEEQSEKQERLEQRDRQRRDEELWRQRQEWQEREERRAEEEQLQSCKGHETEEFPDEEQLRRRELLELRRKGREEKQQQRRERQDRVFQEEEEKEWRKRETVLRKEEEKLQEEEPQRQRELQEEEEQLRKLERQELRRERQEEEQQQQRL
Target-Kategorie: TCHH
Application Verdünnung: WB: WB,1:500 - 1:2000