PPAP2B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15743P
Artikelname: PPAP2B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15743P
Hersteller Artikelnummer: CNA15743P
Alternativnummer: MBL-CNA15743P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PPAP2B (NP_003704.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 8613
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIKPYHRGFYCNDESIKYPLKTGETINDAVLCAVGIVIAILAI
Target-Kategorie: PLPP3
Application Verdünnung: WB: WB,1:500 - 1:1000