KIF3B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15754T
Artikelname: KIF3B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15754T
Hersteller Artikelnummer: CNA15754T
Alternativnummer: MBL-CNA15754T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 663-747 of human KIF3B (NP_004789.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 85kDa
NCBI: 9371
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: LELDMPSRTTRDYEGPAIAPKVQAALDAALQDEDEIQVDASSFESTANKKSKARPKSGRKSGSSSSSSGTPASQLYPQSRGLVPK
Target-Kategorie: KIF3B
Application Verdünnung: WB: WB,1:500 - 1:2000