MED20 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15757T
Artikelname: MED20 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15757T
Hersteller Artikelnummer: CNA15757T
Alternativnummer: MBL-CNA15757T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-212 of human MED20 (NP_004266.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 23kDa
NCBI: 9477
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MGVTCVSQMPVAEGKSVQQTVELLTRKLEMLGAEKQGTFCVDCETYHTAASTLGSQGQTGKLMYVMHNSEYPLSCFALFENGPCLIADTNFDVLMVKLKGFFQSAKASKIETRGTRYQYCDFLVKVGTVTMGPSARGISVEVEYGPCVVASDCWSLLLEFLQSFLGSHTPGAPAVFGNRHDAVYGPADTMVQYMELFNKIRKQQQVPVAGIR
Target-Kategorie: MED20
Application Verdünnung: WB: WB,1:500 - 1:2000