Bim Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15771P
Artikelname: Bim Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15771P
Hersteller Artikelnummer: CNA15771P
Alternativnummer: MBL-CNA15771P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-198 of human Bim (NP_619527.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 22kDa
NCBI: 10018
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: DTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH
Target-Kategorie: BCL2L11
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200