APPBP2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15781T
Artikelname: APPBP2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15781T
Hersteller Artikelnummer: CNA15781T
Alternativnummer: MBL-CNA15781T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 386-585 of human APPBP2 (NP_006371.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 67kDa
NCBI: 10513
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: LEEIAIDCHNKETEQRLLQEAHDLHLSSLQLAKKAFGEFNVQTAKHYGNLGRLYQSMRKFKEAEEMHIKAIQIKEQLLGQEDYEVALSVGHLASLYNYDMNQYENAEKLYLRSIAIGKKLFGEGYSGLEYDYRGLIKLYNSIGNYEKVFEYHNVLSNWNRLRDRQYSVTDALEDVSTSPQSTEEVVQSFLISQNVEGPSC
Target-Kategorie: APPBP2
Application Verdünnung: WB: WB,1:500 - 1:2000