KIF1C Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15786T
Artikelname: KIF1C Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15786T
Hersteller Artikelnummer: CNA15786T
Alternativnummer: MBL-CNA15786T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 810-960 of human KIF1C (NP_006603.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 123kDa
NCBI: 10749
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: EEGGGAGSGGGSEEGARGAEVEDLRAHIDKLTGILQEVKLQNSSKDRELQALRDRMLRMERVIPLAQDHEDENEEGGEVPWAPPEGSEAAEEAAPSDRMPSARPPSPPLSSWERVSRLMEEDPAFRRGRLRWLKQEQLRLQGLQGSGGRGG
Target-Kategorie: KIF1C
Application Verdünnung: WB: WB,1:500 - 1:2000