ME3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15787T
Artikelname: ME3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15787T
Hersteller Artikelnummer: CNA15787T
Alternativnummer: MBL-CNA15787T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 505-604 of human ME3 (NP_001014811.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 67kDa
NCBI: 10873
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: IRHIPDEIFLLTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVRSLVYTPDYDSFTLDSYTWPKEAMNVQTV
Target-Kategorie: ME3
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200