RABGAP1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15804T
Artikelname: RABGAP1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15804T
Hersteller Artikelnummer: CNA15804T
Alternativnummer: MBL-CNA15804T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 830-1069 of human RABGAP1 (NP_036329.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 122kDa
NCBI: 23637
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: QQEDPIERFERENRRLQEANMRLEQENDDLAHELVTSKIALRKDLDNAEEKADALNKELLMTKQKLIDAEEEKRRLEEESAQLKEMCRRELDKAESEIKKNSSIIGDYKQICSQLSERLEKQQTANKVEIEKIRQKVDDCERCREFFNKEGRVKGISSTKEVLDEDTDEEKETLKNQLREMELELAQTKLQLVEAECKIQDLEHHLGLALNEVQAAKKTWFNRTLSSIKTATGVQGKETC
Target-Kategorie: RABGAP1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200