TAZ Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15806S
Artikelname: TAZ Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15806S
Hersteller Artikelnummer: CNA15806S
Alternativnummer: MBL-CNA15806S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human TAZ (NP_056287.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 44kDa
NCBI: 25937
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: LNGGPYHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNINPQQTRFPDFLDCLPGTNVDLGTLESEDLIPLFNDVESALNKSEPFLTWL
Target-Kategorie: WWTR1
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200