FAM98A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15807T
Artikelname: FAM98A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15807T
Hersteller Artikelnummer: CNA15807T
Alternativnummer: MBL-CNA15807T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human FAM98A (NP_056290.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 55kDa
NCBI: 25940
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MECDLMETDILESLEDLGYKGPLLEDGALSQAVSAGASSPEFTKLCAWLVSELRVLCKLEENVQATNSPSEAEEFQLEVSGLLGEMNCPYLSLTSGDVTKRLLIQKNCLLLLTYLISELEAARMLCVNAPPKKAQEGGGSEVFQELKGICIALGMSKPPANITMFQFFSGIEKKLKETLAKVPPNHVGKPLLKKPMGPAHWEKIEAINQAIANEYEVRRK
Target-Kategorie: FAM98A
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200