FBXO3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15813T
Artikelname: FBXO3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15813T
Hersteller Artikelnummer: CNA15813T
Alternativnummer: MBL-CNA15813T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human FBXO3 (NP_036307.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 55kDa
NCBI: 26273
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MAAMETETAPLTLESLPTDPLLLILSFLDYRDLINCCYVSRRLSQLSSHDPLWRRHCKKYWLISEEEKTQKNQCWKSLFIDTYSDVGRYIDHYAAIKKAWDDLKKYLEPRCPRMVLSLKEGAREEDLDAVEAQIGCKLPDDYRCSYRIHNGQKLVVPGLLGSMALSNHYRSEDLLDVDTAAGGFQQRQGLKYCLPLTFCIHTGLSQYIAVEAAEGRNKNEVFYQCPDQMARNPAAIDMFI
Target-Kategorie: FBXO3
Application Verdünnung: WB: WB,1:500 - 1:2000