TIMM8B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15814T
Artikelname: TIMM8B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15814T
Hersteller Artikelnummer: CNA15814T
Alternativnummer: MBL-CNA15814T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 16-98 of human TIMM8B (NP_036591.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 9kDa
NCBI: 26521
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MAELGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAITSRFAQIVQKGGQ
Target-Kategorie: TIMM8B
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:100