PPA2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15819T
Artikelname: PPA2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15819T
Hersteller Artikelnummer: CNA15819T
Alternativnummer: MBL-CNA15819T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 33-100 of human PPA2 (NP_008834.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 38kDa
NCBI: 27068
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: ALYHTEERGQPCSQNYRLFFKNVTGHYISPFHDIPLKVNSKEENGIPMKKARNDEYENLFNMIVEIPR
Target-Kategorie: PPA2
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:100