MCAT Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15822T
Artikelname: MCAT Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15822T
Hersteller Artikelnummer: CNA15822T
Alternativnummer: MBL-CNA15822T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 191-390 of human MCAT (NP_775738.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 43kDa
NCBI: 27349
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: SGMLSVLGQPQSKFNFACLEAREHCKSLGIENPVCEVSNYLFPDCRVISGHQEALRFLQKNSSKFHFRRTRMLPVSGAFHTRLMEPAVEPLTQALKAVDIKKPLVSVYSNVHAHRYRHPGHIHKLLAQQLVSPVKWEQTMHAIYERKKGRGFPQTFEVGPGRQLGAILKSCNMQAWKSYSAVDVLQTLEHVDLDPQEPPR
Target-Kategorie: MCAT
Application Verdünnung: WB: WB,1:500 - 1:2000