RPS27L Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15833T
Artikelname: RPS27L Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15833T
Hersteller Artikelnummer: CNA15833T
Alternativnummer: MBL-CNA15833T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-84 of human RPS27L (NP_057004.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 9kDa
NCBI: 51065
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH
Target-Kategorie: RPS27L
Application Verdünnung: WB: WB,1:500 - 1:2000