PLLP Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15834T
Artikelname: PLLP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15834T
Hersteller Artikelnummer: CNA15834T
Alternativnummer: MBL-CNA15834T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PLLP (NP_057077.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 20kDa
NCBI: 51090
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MAEFPSKVSTRTSSPAQGAEASVSALRPDLGFVRSRLGALMLLQLVLGLLVWALIADTPYHLYPAYGWVMFVAVFLWLVTIVLFNLYLFQLHMKLYMVPW
Target-Kategorie: PLLP
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200