SR-BI Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1584P
Artikelname: SR-BI Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1584P
Hersteller Artikelnummer: CNA1584P
Alternativnummer: MBL-CNA1584P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SR-BI (NP_005496.4).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 61kDa
NCBI: 949
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSSLSFNMWKEIPIPFYLSVYFFDVMNPSEILKGEKPQVRERGPYVYREFRHK
Target-Kategorie: SCARB1
Application Verdünnung: WB: WB,1:500 - 1:1000