UCKL1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15851T
Artikelname: UCKL1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15851T
Hersteller Artikelnummer: CNA15851T
Alternativnummer: MBL-CNA15851T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human UCKL1 (NP_060329.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 61kDa
NCBI: 54963
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MAAPPARADADPSPTSPPTARDTPGRQAEKSETACEDRSNAESLDRLLPPVGTGRSPRKRTTSQCKSEPPLLRTSKRTIYTAGRPPWYNEHGTQSKEAFAIGLGGGSASGKTTVARMIIEALDVPWVVLLSMDSFYKVLTEQQQEQAAHNNFNFDHPDAFDFDLIISTLKKLKQGKSVKVPIYDFTTHSRKKDWKTLYGA
Target-Kategorie: UCKL1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200