OXSM Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15852T
Artikelname: OXSM Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15852T
Hersteller Artikelnummer: CNA15852T
Alternativnummer: MBL-CNA15852T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 80-459 of human OXSM (NP_060367.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 49kDa
NCBI: 54995
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: EYKSIPCSVAAYVPRGSDEGQFNEQNFVSKSDIKSMSSPTIMAIGAAELAMKDSGWHPQSEADQVATGVAIGMGMIPLEVVSETALNFQTKGYNKVSPFFVPKILVNMAAGQVSIRYKLKGPNHAVSTACTTGAHAVGDSFRFIAHGDADVMVAGGTDSCISPLSLAGFSRARALSTNSDPKLACRPFHPKRDGFVMGEGAAVLVLEEYEHAVQRRARIYAEVLGYGLSGDAGHITAPDPEGEGALRCMAAALK
Target-Kategorie: OXSM
Application Verdünnung: WB: WB,1:500 - 1:2000