RPRD1A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15854T
Artikelname: RPRD1A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15854T
Hersteller Artikelnummer: CNA15854T
Alternativnummer: MBL-CNA15854T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 47-276 of human RPRD1A (NP_001290341.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 36kDa
NCBI: 55197
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: PVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTYEQIKVDENENCSSLGSPSEPPQTLDLVRALQDLENAASGDAAVHQRIASLPVEVQEVSLLDKITDKESGERLSKMVEDACMLLADYNGRLAAEIDDRKQLTRMLADFLRCQKEALAEKEHKLEEYKRKLARVSLVRKELRSRIQSLPDLSRLPNVTGSHMHLPFAGDIYSED
Target-Kategorie: RPRD1A
Application Verdünnung: WB: WB,1:500 - 1:2000