ELP2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15857T
Artikelname: ELP2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15857T
Hersteller Artikelnummer: CNA15857T
Alternativnummer: MBL-CNA15857T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 300-600 of human ELP2 (NP_001229808.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 93kDa
NCBI: 55250
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: QNTVNPREWTPEIVISGHFDGVQDLVWDPEGEFIITVGTDQTTRLFAPWKRKDQSQVTWHEIARPQIHGYDLKCLAMINRFQFVSGADEKVLRVFSAPRNFVENFCAITGQSLNHVLCNQDSDLPEGATVPALGLSNKAVFQGDIASQPSDEEELLTSTGFEYQQVAFQPSILTEPPTEDHLLQNTLWPEVQKLYGHGYEIFCVTCNSSKTLLASACKAAKKEHAAIILWNTTSWKQVQNLVFHSLTVTQMAFS
Target-Kategorie: ELP2
Application Verdünnung: WB: WB,1:500 - 1:2000