DDX43 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15858T
Artikelname: DDX43 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15858T
Hersteller Artikelnummer: CNA15858T
Alternativnummer: MBL-CNA15858T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 429-648 of human DDX43 (NP_061135.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 73kDa
NCBI: 55510
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: TWPHSVHRLAQSYLKEPMIVYVGTLDLVAVSSVKQNIIVTTEEEKWSHMQTFLQSMSSTDKVIVFVSRKAVADHLSSDLILGNISVESLHGDREQRDREKALENFKTGKVRILIATDLASRGLDVHDVTHVYNFDFPRNIEEYVHRIGRTGRAGRTGVSITTLTRNDWRVASELINILERANQSIPEELVSMAERFKAHQQKREMERKMERPQGRPKKFH
Target-Kategorie: DDX43
Application Verdünnung: WB: WB,1:500 - 1:2000