Renin Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1585P
Artikelname: Renin Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1585P
Hersteller Artikelnummer: CNA1585P
Alternativnummer: MBL-CNA1585P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 24-160 of human Renin (NP_000528.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 45kDa
NCBI: 5972
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: LPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQ
Target-Kategorie: REN
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:100 - 1:200