PPIL4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15920T
Artikelname: PPIL4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15920T
Hersteller Artikelnummer: CNA15920T
Alternativnummer: MBL-CNA15920T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 301-492 of human PPIL4 (NP_624311.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 57kDa
NCBI: 85313
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MDNVLIDDRRIHVDFSQSVAKVKWKGKGGKYTKSDFKEYEKEQDKPPNLVLKDKVKPKQDTKYDLILDEQAEDSKSSHSHTSKKHKKKTHHCSEEKEDEDYMPIKNTNQDIYREMGFGHYEEEESCWEKQKSEKRDRTQNRSRSRSRERDGHYSNSHKSKYQTDLYERERSKKRDRSRSPKKSKDKEKSKYR
Target-Kategorie: PPIL4
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200