TP53I13 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15924T
Artikelname: TP53I13 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15924T
Hersteller Artikelnummer: CNA15924T
Alternativnummer: MBL-CNA15924T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 180-310 of human TP53I13 (NP_612358.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 42kDa
NCBI: 90313
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: RSWRPPGTEVTSQGPRQPSSSGAKRRRLRAALGPQPTRSALRFPSASPGSLKAKQSMAGIPGRESNAPSVPTVSLLPGAPGGNASSRTEAQVPNGQGSPGGCVCSSQASPAPRAAAPPRAARGPTPRTEEA
Target-Kategorie: TP53I13
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200