Bad Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1593S
Artikelname: Bad Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1593S
Hersteller Artikelnummer: CNA1593S
Alternativnummer: MBL-CNA1593S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 110 to the C-terminus of human Bad (NP_004313.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 18kDa
NCBI: 572
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: YGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
Target-Kategorie: BAD
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:10 - 1:100