CHCHD1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15941T
Artikelname: CHCHD1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15941T
Hersteller Artikelnummer: CNA15941T
Alternativnummer: MBL-CNA15941T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human CHCHD1 (NP_976043.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 13kDa
NCBI: 118487
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MATPSLRGRLARFGNPRKPVLKPNKPLILANRVGERRREKGEATCITEMSVMMACWKQNEFRDDACRKEIQGFLDCAARAQEARKMRSIQETLGESGSLLPNKLNKLLQRFPNKPYLS
Target-Kategorie: CHCHD1
Application Verdünnung: WB: WB,1:500 - 1:2000