TPRG1L Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15949T
Artikelname: TPRG1L Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15949T
Hersteller Artikelnummer: CNA15949T
Alternativnummer: MBL-CNA15949T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human TPRG1L (NP_877429.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 30kDa
NCBI: 127262
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MLQLRDSVDSAGTSPTAVLAAGEEVGAGGGPGGGRPGAGTPLRQTLWPLSIHDPTRRARVKEYFVFRPGSIEQAVEEIRVVVRPVEDGEI
Target-Kategorie: TPRG1L
Application Verdünnung: WB: WB,1:500 - 1:2000