Cathepsin D Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1594S
Artikelname: Cathepsin D Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1594S
Hersteller Artikelnummer: CNA1594S
Alternativnummer: MBL-CNA1594S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 65-412 of human Cathepsin D (NP_001900.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 45kDa
NCBI: 1509
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: GPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAV
Target-Kategorie: CTSD
Application Verdünnung: WB: WB,1:500 - 1:2000