EDARADD Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15950T
Artikelname: EDARADD Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15950T
Hersteller Artikelnummer: CNA15950T
Alternativnummer: MBL-CNA15950T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-215 of human EDARADD (NP_665860.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 25kDa
NCBI: 128178
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MGLRTTKQMGRGTKAPGHQEDHMVKEPVEDTDPSTLSFNMSDKYPIQDTELPKAEECDTITLNCPRNSDMKNQGEENGFPDSTGDPLPEISKDNSCKENCTCSSCLLRAPTISDLLNDQDLLDVIRIKLDPCHPTVKNWRNFASKWGMSYDELCFLEQRPQSPTLEFLLRNSQRTVGQLMELCRLYHRADVEKVLRRWVDEEWPKRERGDPSRHF
Target-Kategorie: EDARADD
Application Verdünnung: WB: WB,1:500 - 1:2000