NAXE Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15952T
Artikelname: NAXE Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15952T
Hersteller Artikelnummer: CNA15952T
Alternativnummer: MBL-CNA15952T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 48-170 of human NAXE (NP_658985.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 32kDa
NCBI: 128240
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: DSEVMASTVVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVLVICGPGNNGGDGLVCARHLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMP
Target-Kategorie: NAXE
Application Verdünnung: WB: WB,1:500 - 1:2000