ACMSD Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15953T
Artikelname: ACMSD Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15953T
Hersteller Artikelnummer: CNA15953T
Alternativnummer: MBL-CNA15953T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-336 of human ACMSD (NP_612199.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 38kDa
NCBI: 130013
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MKIDIHSHILPKEWPDLKKRFGYGGWVQLQHHSKGEAKLLKDGKVFRVVRENCWDPEVRIREMDQKGVTVQALSTVPVMFSYWAKPEDTLNLCQLLNNDLASTVVSYPRRFVGLGTLPMQAPELAVKEMERCVKELGFPGVQIGTHVNEWDLNAQELFPVYAAAERLKCSLFVHPWDMQMDGRMAKYWLPWLVGMPAETTIAICSMIMGGVFEKFPKLKVCFAHGGGAFPFTVGRISHGFSMRPDLCAQDNPMN
Target-Kategorie: ACMSD
Application Verdünnung: WB: WB,1:500 - 1:2000