SSC4D Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15957T
Artikelname: SSC4D Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15957T
Hersteller Artikelnummer: CNA15957T
Alternativnummer: MBL-CNA15957T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 446-575 of human SSC4D (NP_542782.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 61kDa
NCBI: 136853
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: PEELGLQVQQDGSETTRVPTPRPRDGHLRLVNGAHRCEGRVELYLGQRWGTVCDDAWDLRAAGVLCRQLGCGQALAAPGEAHFGPGRGPILLDNVKCRGEESALLLCSHIRWDAHNCDHSEDASVLCQPS
Target-Kategorie: SSC4D
Application Verdünnung: WB: WB,1:500 - 1:2000