HSCB Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15961T
Artikelname: HSCB Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15961T
Hersteller Artikelnummer: CNA15961T
Alternativnummer: MBL-CNA15961T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 30-235 of human HSCB (NP_741999.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 27kDa
NCBI: 150274
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: AASQAGSNYPRCWNCGGPWGPGREDRFFCPQCRALQAPDPTRDYFSLMDCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLYLLKLHGIEIPERTDYEMDRQFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEEAKEILTKMRYFSNIEEKIKLKKIPL
Target-Kategorie: HSCB
Application Verdünnung: WB: WB,1:500 - 1:2000