MUC20 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15968T
Artikelname: MUC20 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15968T
Hersteller Artikelnummer: CNA15968T
Alternativnummer: MBL-CNA15968T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MUC20 (NP_689886.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 72kDa
NCBI: 200958
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: PNFMVLIATSVETSAASGSPEGAGMTTVQTITGSDPEEAIFDTLCTDDSSEEAKTLTMDILTLAHTSTEAKGLSSESSASSDGPHPVITPSRASESSASSD
Target-Kategorie: MUC20
Application Verdünnung: WB: WB,1:500 - 1:2000