ANT1/ANT2/ANT3/ANT4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15988T
Artikelname: ANT1/ANT2/ANT3/ANT4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15988T
Hersteller Artikelnummer: CNA15988T
Alternativnummer: MBL-CNA15988T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human ANT1 (NP_001142.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 33kDa/32kDa/35kDa
NCBI: 291
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: GMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV
Target-Kategorie: ANT1/ANT2/ANT3/ANT4
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200