SLC14A1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15991P
Artikelname: SLC14A1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15991P
Hersteller Artikelnummer: CNA15991P
Alternativnummer: MBL-CNA15991P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human SLC14A1 (NP_001295208.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 43kDa
NCBI: 6563
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: QIYGCDNPWTGGIFLGAILLSSPLMCLHAAIGSLLGIAAGLSLSAPFEDIYFGLWGFNSSLACIAMGGMFMALTWQTHLLALGCALFTAYLGVGMANFMAEVGLPACTWPFCLATLLFLIMTTKNSNIYKMPLSKVTYPEENRIFYLQAKKRMVESPL
Target-Kategorie: SLC14A1
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200