CENPA Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA15995P
Artikelname: CENPA Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA15995P
Hersteller Artikelnummer: CNA15995P
Alternativnummer: MBL-CNA15995P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CENPA (NP_001800.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 16kDa
NCBI: 1058
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEA
Target-Kategorie: CENPA
Application Verdünnung: WB: WB,1:500 - 1:1000