SULT1A1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1599S
Artikelname: SULT1A1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1599S
Hersteller Artikelnummer: CNA1599S
Alternativnummer: MBL-CNA1599S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-295 of human SULT1A1 (NP_803565.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 6817
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISP
Target-Kategorie: SULT1A1
Application Verdünnung: WB: WB,1:500 - 1:2000