KDM2B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16017T
Artikelname: KDM2B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16017T
Hersteller Artikelnummer: CNA16017T
Alternativnummer: MBL-CNA16017T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 600-700 of human KDM2B (XP_011537177.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 153kDa
NCBI: 84678
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: SGCSWIAVSALCSSSCPLLRTLDVQWVEGLKDAQMRDLLSPPTDNRPGQMDNRSKLRNIVELRLAGLDITDASLRLIIRHMPLLSKLHLSYCNHVTDQSIN
Target-Kategorie: KDM2B
Application Verdünnung: WB: WB,1:500 - 1:2000