ZNRF3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16026S1
Artikelname: ZNRF3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16026S1
Hersteller Artikelnummer: CNA16026S1
Alternativnummer: MBL-CNA16026S1
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human ZNRF3 (NP_001193927.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 101kDa
NCBI: 84133
Puffer: PBS with 0.09% Sodium azide,50% glycerol
Quelle: Rabbit
Sequenz: PGAARAKETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRG
Target-Kategorie: ZNRF3
Application Verdünnung: WB: WB,1:1000 - 1:5000|IHC-P,1:50 - 1:200