GLS2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16029P
Artikelname: GLS2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16029P
Hersteller Artikelnummer: CNA16029P
Alternativnummer: MBL-CNA16029P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 500-602 of human GLS2 (NP_037399.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 66kDa
NCBI: 27165
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: SALRRFALSAMDMEQKDYDSRTALHVAAAEGHIEVVKFLIEACKVNPFAKDRWGNIPLDDAVQFNHLEVVKLLQDYQDSYTLSETQAEAAAEALSKENLESMV
Target-Kategorie: GLS2
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200