CLNS1A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16040T
Artikelname: CLNS1A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16040T
Hersteller Artikelnummer: CNA16040T
Alternativnummer: MBL-CNA16040T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-237 of human CLNS1A (NP_001284.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 26kDa
NCBI: 1207
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MSFLKSFPPPGPAEGLLRQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHALSRDRSDCLGEHLYVMVNAKFEEESKEPVADEEEEDSDDDVEPITEFRFVPSDKSALEAMFTAMCECQALHPDPEDEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQATLERLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQFEDADVDH
Target-Kategorie: CLNS1A
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100