DCT Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16041T
Artikelname: DCT Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16041T
Hersteller Artikelnummer: CNA16041T
Alternativnummer: MBL-CNA16041T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 50-350 of human DCT (NP_001913.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 59kDa
NCBI: 1638
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: NVCGSQQGRGQCTEVRADTRPWSGPYILRNQDDRELWPRKFFHRTCKCTGNFAGYNCGDCKFGWTGPNCERKKPPVIRQNIHSLSPQEREQFLGALDLAKKRVHPDYVITTQHWLGLLGPNGTQPQFANCSVYDFFVWLHYYSVRDTLLGPGRPYRAIDFSHQGPAFVTWHRYHLLCLERDLQRLIGNESFALPYWNFATGRNECDVCTDQLFGAARPDDPTLISRNSRFSSWETVCDSLDDYNHLVTLCNGTY
Target-Kategorie: DCT
Application Verdünnung: WB: WB,1:500 - 1:2000